PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0026000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 245aa    MW: 26835.5 Da    PI: 8.7441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0026000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-1598143147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l  +v ++G+ +W++Ia+++  gR++k+c++rw++ 
   Spipo4G0026000  98 RGHWRPAEDAKLRVLVSLHGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 143
                      899*****************************.***********996 PP

2Myb_DNA-binding56.75.4e-18150193146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l  a++ +G++ W++Iar ++ gRt++ +k++w+ 
   Spipo4G0026000 150 RRAFTEEEEEKLMAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHV 193
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.73692144IPR017930Myb domain
SMARTSM007177.0E-1397146IPR001005SANT/Myb domain
PfamPF002492.8E-1598143IPR001005SANT/Myb domain
SuperFamilySSF466894.87E-2898191IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-2699151IPR009057Homeodomain-like
CDDcd001671.25E-12101142No hitNo description
PROSITE profilePS5129427.346145199IPR017930Myb domain
SMARTSM007172.5E-15149197IPR001005SANT/Myb domain
PfamPF002493.3E-15150192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-21152198IPR009057Homeodomain-like
CDDcd001671.40E-12152192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MMAMKHVHSP QDMVFADMGT LSIDSSSSSL AGGGRVLGKD RPLGDTFPLF EVHREKAGDV  60
ASEDSSFIAI DETIASGMED PSSKKRIGEG TQPKLYARGH WRPAEDAKLR VLVSLHGPQN  120
WNLIAEKLEG RSGKSCRLRW FNQLDPRINR RAFTEEEEEK LMAAHRAYGN KWALIARLFP  180
GRTDNAVKNH WHVIMSRKTA MQERNLGGGD TPRLFPADGG GHAAVDPLCF WPLGLVVSGG  240
GHAV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31971996108B-MYB
1mse_C2e-31951991105C-Myb DNA-Binding Domain
1msf_C2e-31951991105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008783843.15e-72PREDICTED: myb-like protein AA
TrEMBLK7L3D62e-69K7L3D6_SOYBN; Uncharacterized protein
STRINGGLYMA07G35581.15e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-64myb domain protein 105